PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00017166001
Common NameGSBRNA2T00017166001, LOC106435037
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 387aa    MW: 43010.5 Da    PI: 5.628
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00017166001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.81.5e-05234335
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                         e+kC+ +   +++++C+ +   lC +C ++ H+
  GSBRNA2T00017166001  2 EPKCDYCATTQAIIYCKYDLAKLCLKCDVHVHS 34
                         689******99******************9994 PP

2CCT62.31.5e-21329372144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          R++a+lRYkeK+ +R F K+irY+sRKa+A++R+RvKGrFvk+ 
  GSBRNA2T00017166001 329 RNEAKLRYKEKKLKRTFGKQIRYASRKARADTRKRVKGRFVKAG 372
                          99***************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.5E-6147IPR000315B-box-type zinc finger
CDDcd000210.00541334No hitNo description
PROSITE profilePS5101714.436329371IPR010402CCT domain
PfamPF062035.3E-16329371IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MEPKCDYCAT TQAIIYCKYD LAKLCLKCDV HVHSPNPLSR RHMRSLICEK CFSQPAVIRC  60
LDQKVSYCQG CQWHVRSCSA LGHRLQSLEP FSGCPSPTEF SRMWSSILEP SVSSLVNPSI  120
GSLPLADPNN DMFEMSKINE LDDLIGSSYS MMSQNITYIQ NLSDQSSFFS GDSKGCPDLI  180
LKLEEGEEDL CEGLNLDNAP LNFDVGDDII CCSPQEHIES DQTLPNGPLA YKNIISVTDS  240
NFTTDNPLEA TSTGHQDCKS YHQSGPLQMN INIGLPLPTS PILFGQINPN IKGHESTAVE  300
YQDCGMSTGL IMSDSPWESN LEVGSPQTRN EAKLRYKEKK LKRTFGKQIR YASRKARADT  360
RKRVKGRFVK AGDNYDYDPS SPTTNQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013731345.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 12-like
SwissprotQ9LJ440.0COL12_ARATH; Zinc finger protein CONSTANS-LIKE 12
TrEMBLA0A078J1600.0A0A078J160_BRANA; BnaA01g36580D protein
STRINGBra023858.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53192240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.11e-179B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]